moloX




Recombinant Proteins » Homo sapiens » NUP214

Details of (Homo sapiens) NUP214
Construct1-450
DescriptionAminoterminal WD40 (beta propeller) domain of Nucleoporin 214. Nuclear pore complex protein Nup214 Alternative name(s): 214 kDa nucleoporin Nucleoporin Nup214 Protein CAN
Purity>95%
Quantity1, 10, 100, 1000
Protein Tagnone
Uniprothttp://www.uniprot.org/uniprot/P35658
Gene IDNUP214
Statementresearch purposes only - not for human use
Shippingdry ice
Storage4°C
Applicationin vitro use only
SequenceMGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKYGLVFAGGASGLQ IFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHHLALSCDNLTLSACMMSSEYGSII AFFDVRTFSNEAKQQKRPFAYHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQYLPTLQEKKVIPCPPFYESDHP VRVLDVLWIGTYVFAIVYAAADGTLETSPDVVMALLPKKEEKHPEIFVNFMEPCYG
Referencehttp://www.ncbi.nlm.nih.gov/pubmed/19219046

Order Protein NUP214

You will receive an E-Mail with a confirmation link to verify your E-Mail-Adress.

I agree that moloX uses the personal data I provide to get in touch with me according to their terms and conditions. *