moloX




Recombinant Proteins » Homo sapiens » SLIP1 (MIF4G domain-containing protein)

Details of (Homo sapiens) SLIP1 (MIF4G domain-containing protein)
Constructfull length
DescriptionMIF4G domain-containing protein Alternative name(s): SLBP-interacting protein 1 Short name=hSLIP1 Functions in replication-dependent translation of histone mRNAs which differ from other eukaryotic mRNAs in that they do not end with a poly-A tail but a stem-loop. May participate in circularizing those mRNAs specifically enhancing their translation. Interacts with EIF4G1, EIF4G2 and SLBP; probably tethered by SLBP to the 3'-end of mRNAs ending with the histone stem-loop, it also interacts with EIF4G1 which is bound to their 5'-end. Interacts with DDX19B.
Purity>95%
Quantity1, 10, 100, 1000
Protein Tagnone
Uniprothttp://www.uniprot.org/uniprot/A9UHW6
Gene IDMIF4GD; Slip1
Statementresearch purposes only - not for human use
Shippingdry ice
Storage4°C
Applicationin vitro use only
SequenceMGEPSREEYKIQSFDAETQQLLKTALKDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCY AIIQAESKQAGQSVFRRGLLNRLQQEYQAREQLRARSLQGWVCYVTFICNIFDYLRVNNM PMMALVNPVYDCLFRLAQPDSLSKEEEVDCLVLQLHRVGEQLEKMNGQRMDELFVLIRDG FLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD
Referencehttp://www.ncbi.nlm.nih.gov/pubmed/23804756

Order Protein SLIP1 (MIF4G domain-containing protein)

You will receive an E-Mail with a confirmation link to verify your E-Mail-Adress.

I agree that moloX uses the personal data I provide to get in touch with me according to their terms and conditions. *