moloX




Recombinant Proteins » Homo sapiens » DDX19 (Dbp5)

Details of (Homo sapiens) DDX19 (Dbp5)
Constructfull length
Descriptionhuman full length DDX19 Alternative name(s): DEAD box RNA helicase DEAD5 DEAD box protein 19B DBP5 DEAD box protein 5 Helicase CA5/6 Ribonucleic acid-trafficking protein 8 Interacts with NUP214 or RNA in a mutually exclusive manner. Interacts with Slip1.
Purity>95% (SDS PAGE)
Quantity10, 100, 1000 µg, more protein is available upon request
Protein Tagnone
Uniprothttp://www.uniprot.org/uniprot/Q9UMR2
Gene IDDDX19B
Statementresearch purposes only - not for human use
Shippingdry ice
Storage4°C
Applicationin vitro use only
SequenceMATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQS LLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQE NALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGK VIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFV LDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIK
Referencehttp://www.ncbi.nlm.nih.gov/pubmed/19219046

Order Protein DDX19 (Dbp5)

You will receive an E-Mail with a confirmation link to verify your E-Mail-Adress.

I agree that moloX uses the personal data I provide to get in touch with me according to their terms and conditions. *